FXYD5 Antibody - N-terminal region (ARP37690_T100)

• Product Number: ARP37690_T100
• Name: FXYD5 Antibody - N-terminal region (ARP37690_T100)
• Protein Size (# AA): 178 amino acids
• Molecular Weight: 20kDa
• NCBI Gene Id: 53827
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: FXYD domain containing ion transport regulator 5
• Alias Symbols: RIC, IWU1, KCT1, OIT2, DYSAD, HSPC113, PRO6241
• Peptide Sequence: Synthetic peptide located within the following region: LQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDD
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Batistatou,A., et al., (2005) Br. J. Cancer 93 (12), 1382-1387
• Description of Target: FXYD5 is a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIon Channel (Related to Ion Channel). FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIon Channel) have been shown to induce channel activity in experimental expression systems. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. This gene product, FXYD5, has not been characterized as a protein.
• Protein Interactions: UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-FXYD5 (ARP37690_T100) antibody is Catalog # AAP37690 (Previous Catalog # AAPP09024)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FXYD5
• Uniprot ID: Q96DB9
• Protein Name: FXYD domain-containing ion transport regulator 5
• Protein Accession #: NP_659003
• Purification: Protein A purified
• Nucleotide Accession #: NM_144779
• Tested Species Reactivity: Human
• Gene Symbol: FXYD5
• Predicted Species Reactivity: Human, Mouse, Yeast
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Mouse: 100%; Yeast: 90%
• Image 1: Human 293T
  
  Lanes:
  Lane 1: 10ug hFXYD5 transfected 293T lysate
  Lane 2: 10ug 293T lysate
  Primary Antibody Dilution:
  1:1000
  Secondary Antibody:
  Anti-rabbit HRP
  Secondary Antibody Dilution:
  1:4000
  Gene Name:
  FXYD5
  Submitted by:
  Anonymous
  
• Image 2: Human Placenta
  
  WB Suggested Anti-FXYD5 Antibody Titration: 0.625ug/ml
  ELISA Titer: 1:312500
  Positive Control: Human Placenta