KCNAB2 Antibody - middle region (ARP37678_P050)

Data Sheet
 
Product Number ARP37678_P050
Product Page www.avivasysbio.com/kcnab2-antibody-middle-region-arp37678-p050.html
Name KCNAB2 Antibody - middle region (ARP37678_P050)
Protein Size (# AA) 367 amino acids
Molecular Weight 40kDa
Subunit beta-2
NCBI Gene Id 8514
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Potassium voltage-gated channel, shaker-related subfamily, beta member 2
Alias Symbols AKR6A5, KCNA2B, HKvbeta2, KV-BETA-2, HKvbeta2.1, HKvbeta2.2
Peptide Sequence Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Gu,C., et al., (2003) Science 301 (5633), 646-649
Description of Target The functions of Voltage-gated potassium (Kv) channels include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNAB2 is a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits.
Protein Interactions KCNAB2; SIRT1; KCNA5; KCNA4; UBC; RPA3; RPA2; RPA1; ATXN1; Nedd4; NEDD4L; SLC39A2; SLC39A1; SQSTM1; CD4; KCNA2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KCNAB2 (ARP37678_P050) antibody
Blocking Peptide For anti-KCNAB2 (ARP37678_P050) antibody is Catalog # AAP37678 (Previous Catalog # AAPP09012)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human KCNAB2
Uniprot ID Q13303
Protein Name Voltage-gated potassium channel subunit beta-2
Sample Type Confirmation

KCNAB2 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_003627
Purification Affinity Purified
Nucleotide Accession # NM_003636
Tested Species Reactivity Human, Mouse
Gene Symbol KCNAB2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%; Zebrafish: 100%
Image 1
Human Jurkat
WB Suggested Anti-KCNAB2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysateKCNAB2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells
Image 2
Human Jurkat
WB Suggested Anti-KCNAB2 Antibody
Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate
Image 3
Mouse Brain
Sample Type: P48 Mouse
Dilution: 1:2000 tested with brain slices in Immunohistochemistry
Image 4
Human Kidney
Rabbit Anti-KCBAB2 Antibody
Catalog Number: ARP37678
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 5
Human HepG2
WB Suggested Anti-KCNAB2 antibody Titration: 1 ug/mL
Sample Type: Human HepG2
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com