FOXK1 Antibody - C-terminal region (ARP37627_T100)

• Product Number: ARP37627_T100
• Name: FOXK1 Antibody - C-terminal region (ARP37627_T100)
• Protein Size (# AA): 617 amino acids
• Molecular Weight: 68kDa
• NCBI Gene Id: 17425
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Forkhead box K1
• Alias Symbols: Mn, Mnf, Gm10868, AI463295, A630048H08Rik
• Peptide Sequence: Synthetic peptide located within the following region: VVQQAPTVTMVRVVTTSANSANGYILASQGSTGTSHDTAGTAVLDLGNEA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Wijchers,P.J., (2006) Brain Res. 1068 (1), 23-33
• Description of Target: Foxk1 is a transcriptional regulator that binds to the upstream enhancer region (CCAC box) of myoglobin gene. It has a role in myogenic differentiation and in remodeling processes of adult muscles that occur in response to physiological stimuli.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-FOXK1 (ARP37627_T100) antibody is Catalog # AAP37627 (Previous Catalog # AAPS05904)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse FOXK1
• Uniprot ID: P42128
• Protein Name: Forkhead box protein K1
• Protein Accession #: NP_951031
• Purification: Protein A purified
• Nucleotide Accession #: NM_199068
• Tested Species Reactivity: Mouse
• Gene Symbol: FOXK1
• Predicted Species Reactivity: Mouse, Rat, Guinea Pig
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Guinea Pig: 86%; Mouse: 100%; Rat: 93%
• Image 1: Mouse NIH-3T3
  
  WB Suggested Anti-FOXK1 Antibody Titration: 2.5ug/ml
  Positive Control: NIH/3T3 cell lysate
• Image 2: Mouse Kidney
  
  Mouse Kidney