FOXO6 Antibody - N-terminal region (ARP37610_T100)

• Product Number: ARP37610_T100
• Name: FOXO6 Antibody - N-terminal region (ARP37610_T100)
• Protein Size (# AA): 492 amino acids
• Molecular Weight: 51 kDa
• NCBI Gene Id: 329934
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Forkhead box O6
• Peptide Sequence: Synthetic peptide located within the following region: KTPRRRAVSMDNGAKFLRIKGKASKKKQLHLPERSPDDSPPGAPVPGPLS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Wijchers,P.J., et al., (2006) Brain Res. 1068 (1), 23-33
• Description of Target: Murine Foxo6 is a member of the murine forkhead family of transcription factors. This family consists of over 30 members, the vast majority of which is important in embryonic development. These forkhead transcription factors may play a role in maintenance and survival of developing and adult neurons.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-FOXO6 (ARP37610_T100) antibody is Catalog # AAP37610 (Previous Catalog # AAPP09851)
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Uniprot ID: Q70KY4
• Protein Name: Forkhead box protein O6
• Protein Accession #: NP_918949
• Purification: Protein A purified
• Nucleotide Accession #: NM_194060
• Tested Species Reactivity: Mouse
• Gene Symbol: FOXO6
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Dog: 86%; Guinea Pig: 86%; Human: 86%; Mouse: 100%; Rat: 100%
• Image 1: Mouse SP2/0
  
  WB Suggested Anti-FOXO6 Antibody Titration: 1.25ug/ml
  ELISA Titer: 1:62500
  Positive Control: SP2/0 cell lysate