| Product Number |
ARP37526_P050 |
| Product Page |
www.avivasysbio.com/b230358a15rik-antibody-middle-region-arp37526-p050.html |
| Name |
B230358A15Rik Antibody - middle region (ARP37526_P050) |
| Protein Size (# AA) |
311 amino acids |
| Molecular Weight |
36kDa |
| NCBI Gene Id |
245525 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Heat shock transcription factor 3 |
| Alias Symbols |
HSF 3, HSTF 3, B230358A15Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: EDKYKSLLDRVMPILKESKKLISSGDQPSGDDGEHPKVPVQDKPMNEESL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Hsf3 (ARP37526_P050) antibody |
| Blocking Peptide |
For anti-Hsf3 (ARP37526_P050) antibody is Catalog # AAP37526 (Previous Catalog # AAPS06103) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
Q8BL67 |
| Protein Name |
Heat shock factor protein 3 Ensembl ENSMUSP00000137314 Ensembl ENSMUSP00000114018 |
| Protein Accession # |
NP_766519 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_172931 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Hsf3 |
| Predicted Species Reactivity |
Mouse, Rat |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Mouse: 100%; Rat: 79% |
| Image 1 | Mouse Liver
 | WB Suggested Anti-B230358A15Rik Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Mouse liver |
|
|
