| Product Number |
ARP37316_T100 |
| Product Page |
www.avivasysbio.com/irx6-antibody-c-terminal-region-arp37316-t100.html |
| Name |
IRX6 Antibody - C-terminal region (ARP37316_T100) |
| Protein Size (# AA) |
439 amino acids |
| Molecular Weight |
48kDa |
| NCBI Gene Id |
64379 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Iroquois related homeobox 6 (Drosophila) |
| Peptide Sequence |
Synthetic peptide located within the following region: RAQSPECHMIPRQPSSIRRLLVPRDSEGEEDSPAAKAFGNSTFTLQGLPL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Pan,L., et al., (2005) Development 132 (4), 703-712 |
| Description of Target |
IRX6 is one Iroquois (Irx) proteins comprise a family of homeodomain-containing transcription factors involved in patterning and regionalization of embryonic tissues in both vertebrates and invertebrates. |
| Protein Interactions |
Emx2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-IRX6 (ARP37316_T100) antibody |
| Blocking Peptide |
For anti-IRX6 (ARP37316_T100) antibody is Catalog # AAP37316 (Previous Catalog # AAPP09517) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse IRX6 |
| Uniprot ID |
Q8BFT1 |
| Protein Name |
Iroquois-class homeodomain protein IRX-6 Ensembl ENSMUSP00000034185 |
| Protein Accession # |
NP_071873 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_022428 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
IRX6 |
| Predicted Species Reactivity |
Mouse, Rat |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Mouse: 100%; Rat: 86% |
| Image 1 | Mouse NIH-3T3
 | WB Suggested Anti-IRX6 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:12500
Positive Control: NIH/3T3 cell lysate |
|
|
