Product Number |
ARP36758_P050 |
Product Page |
www.avivasysbio.com/cacnb2-antibody-n-terminal-region-arp36758-p050.html |
Name |
CACNB2 Antibody - N-terminal region (ARP36758_P050) |
Protein Size (# AA) |
608 amino acids |
Molecular Weight |
67kDa |
Subunit |
beta-2 |
NCBI Gene Id |
783 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Calcium channel, voltage-dependent, beta 2 subunit |
Alias Symbols |
CAB2, MYSB, CAVB2, CACNLB2 |
Peptide Sequence |
Synthetic peptide located within the following region: MNQGSGLDLLKISYGKGARRKNRFKGSDGSTSSDTTSNSFVRQGSADSYT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Harry,J.B., et al., (2004) J. Biol. Chem. 279 (45), 46367-46372 |
Description of Target |
CACNB2 is a subunit of voltage-dependent calcium channel |
Protein Interactions |
REM1; PRKACA; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CACNB2 (ARP36758_P050) antibody |
Blocking Peptide |
For anti-CACNB2 (ARP36758_P050) antibody is Catalog # AAP36758 (Previous Catalog # AAPP08358) |
Immunogen |
The immunogen is a synthetic peptide directed towards the n terminal region of human CACNB2 |
Uniprot ID |
Q6TME2 |
Protein Name |
Voltage-gated calcium channel beta 2 subunit splice variant CavB2cN2 EMBL AAQ97609.1 |
Protein Accession # |
NP_963866 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_201572 |
Tested Species Reactivity |
Human |
Gene Symbol |
CACNB2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-CACNB2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: HepG2 cell lysate |
|
|