CACNB2 Antibody - N-terminal region (ARP36758_P050)

• Product Number: ARP36758_P050
• Name: CACNB2 Antibody - N-terminal region (ARP36758_P050)
• Protein Size (# AA): 608 amino acids
• Molecular Weight: 67kDa
• Subunit: beta-2
• NCBI Gene Id: 783
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Calcium channel, voltage-dependent, beta 2 subunit
• Alias Symbols: CAB2, MYSB, CAVB2, CACNLB2
• Peptide Sequence: Synthetic peptide located within the following region: MNQGSGLDLLKISYGKGARRKNRFKGSDGSTSSDTTSNSFVRQGSADSYT
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Harry,J.B., et al., (2004) J. Biol. Chem. 279 (45), 46367-46372
• Description of Target: CACNB2 is a subunit of voltage-dependent calcium channel
• Protein Interactions: REM1; PRKACA;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CACNB2 (ARP36758_P050) antibody is Catalog # AAP36758 (Previous Catalog # AAPP08358)
• Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of human CACNB2
• Uniprot ID: Q6TME2
• Protein Name: Voltage-gated calcium channel beta 2 subunit splice variant CavB2cN2 EMBL AAQ97609.1
• Protein Accession #: NP_963866
• Purification: Affinity Purified
• Nucleotide Accession #: NM_201572
• Tested Species Reactivity: Human
• Gene Symbol: CACNB2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-CACNB2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: HepG2 cell lysate