MCM7 Antibody - middle region (ARP36667_T100)

Data Sheet
 
Product Number ARP36667_T100
Product Page www.avivasysbio.com/mcm7-antibody-middle-region-arp36667-t100.html
Name MCM7 Antibody - middle region (ARP36667_T100)
Protein Size (# AA) 389 amino acids
Molecular Weight 42kDa
NCBI Gene Id 4176
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Minichromosome maintenance complex component 7
Alias Symbols MCM2, CDC47, P85MCM, P1CDC47, PNAS146, PPP1R104, P1.1-MCM3
Peptide Sequence Synthetic peptide located within the following region: GGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Wang,Y., et al., (2000) FEBS Lett. 484 (1), 17-21
Description of Target MCM7 encodes a protein that is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 6 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme.
Protein Interactions AK8; MIPOL1; C8orf34; USHBP1; MCMBP; CCDC102B; TRIM54; MBIP; UBQLN1; TRIM27; NAB2; KIFC3; GOLGA2; PNMA1; UBC; SP2; HAUS2; CEP250; CEP57; SUMO2; SUMO3; PCNA; STAU1; SUZ12; RNF2; MCM4; MCM2; HSP90AB1; PRMT1; PRRC1; CLUH; TOMM34; TRIM16; HYOU1; BAG3; MIB1; P
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MCM7 (ARP36667_T100) antibody
Blocking Peptide For anti-MCM7 (ARP36667_T100) antibody is Catalog # AAP36667 (Previous Catalog # AAPP07924)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MCM7
Uniprot ID P33993-2
Protein Name DNA replication licensing factor MCM7
Purification Protein A purified
Tested Species Reactivity Human
Gene Symbol MCM7
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human HepG2
WB Suggested Anti-MCM7 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com