| Product Number |
ARP36610_P050 |
| Product Page |
www.avivasysbio.com/gja5-antibody-n-terminal-region-arp36610-p050.html |
| Name |
GJA5 Antibody - N-terminal region (ARP36610_P050) |
| Protein Size (# AA) |
358 amino acids |
| Molecular Weight |
39kDa |
| NCBI Gene Id |
2702 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Gap junction protein, alpha 5, 40kDa |
| Alias Symbols |
CX40, ATFB11 |
| Peptide Sequence |
Synthetic peptide located within the following region: STPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSGSYEYPVAEKAELSC |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Makita,N., et al., (2005) Acta Neurochir. Suppl. 2 (10), 1128-1134 |
| Description of Target |
GJA5 belongs to the connexin family, alpha-type subfamily. It is an integral membrane protein that forms transmembrane channels, and may function in small molecule transport, muscle contraction and cell-cell communication. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified. |
| Protein Interactions |
RIMS3; MARK1; AAR2; PRKACA; GJA1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GJA5 (ARP36610_P050) antibody |
| Blocking Peptide |
For anti-GJA5 (ARP36610_P050) antibody is Catalog # AAP36610 (Previous Catalog # AAPP07849) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GJA5 |
| Uniprot ID |
P36382 |
| Protein Name |
Gap junction alpha-5 protein |
| Protein Accession # |
NP_005257 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_005266 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GJA5 |
| Predicted Species Reactivity |
Human, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 86%; Horse: 79%; Human: 100%; Pig: 93%; Rabbit: 82%; Rat: 79% |
| Image 1 | Human Lung
 | WB Suggested Anti-GJA5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Lung |
|
|
