ANXA6 Antibody - N-terminal region (ARP36583_T100)

Data Sheet
 
Product Number ARP36583_T100
Product Page www.avivasysbio.com/anxa6-antibody-n-terminal-region-arp36583-t100.html
Name ANXA6 Antibody - N-terminal region (ARP36583_T100)
Protein Size (# AA) 673 amino acids
Molecular Weight 74kDa
NCBI Gene Id 309
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Annexin A6
Alias Symbols p68, p70, ANX6, CBP68, CPB-II
Peptide Sequence Synthetic peptide located within the following region: ALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Cuschieri,J., et al., (2005) Surgery 138 (2), 158-164
Description of Target Annexin VI belongs to a family of calcium-dependent membrane and phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. The annexin VI gene is approximately 60 kbp long and contains 26 exons. It encodes a protein of about 68 kDa that consists of eight 68-amino acid repeats separated by linking sequences of variable lengths. It is highly similar to human annexins I and II sequences, each of which contain four such repeats. Exon 21 of annexin VI is alternatively spliced, giving rise to two isoforms that differ by a 6-amino acid insertion at the start of the seventh repeat. Annexin VI has been implicated in mediating the endosome aggregation and vesicle fusion in secreting epithelia during exocytosis.
Protein Interactions UBC; MDM2; THOP1; PLS3; MTAP; IDH1; HPRT1; GOT1; ADSS; POLE3; NAMPT; UBE2H; ATP4A; METTL18; MLH1; SNCA; CUL5; SIRT7; PRKCA; TJP1; CD4; H2AFX; CDC73; TPD52; S100B; S100A1; RASA1; CR2; A2M; tax;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ANXA6 (ARP36583_T100) antibody
Blocking Peptide For anti-ANXA6 (ARP36583_T100) antibody is Catalog # AAP36583 (Previous Catalog # AAPP07816)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA6
Uniprot ID P08133
Protein Name Annexin A6
Sample Type Confirmation

ANXA6 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_001146
Purification Protein A purified
Nucleotide Accession # NM_001155
Tested Species Reactivity Human
Gene Symbol ANXA6
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 85%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 86%; Rabbit: 85%; Rat: 93%; Zebrafish: 93%
Image 1
Human Jurkat
WB Suggested Anti-ANXA6 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysateANXA6 is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com