DDX50 Antibody - N-terminal region (ARP36497_T100)

• Product Number: ARP36497_T100
• Name: DDX50 Antibody - N-terminal region (ARP36497_T100)
• Protein Size (# AA): 737 amino acids
• Molecular Weight: 81kDa
• NCBI Gene Id: 79009
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 50
• Alias Symbols: GU2, GUB, mcdrh, RH-II/GuB
• Peptide Sequence: Synthetic peptide located within the following region: EESESQKKERQKSDRRKSRHHYDSDEKSETRENGVTDDLDAPKAKKSKMK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Valdez,B.C., et al., (2002) Gene 284 (1-2), 53-61
• Description of Target: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX50 is a DEAD box enzyme that may be involved in ribosomal RNA synthesis or processing. DDX50 and DDX21, also called RH-II/GuA, have similar genomic structures and are in tandem orientation on chromosome 10, suggesting that the two genes arose by gene duplication in evolution. DDX50 gene has pseudogenes on chromosomes 2, 3 and 4. Alternative splicing of this gene generates multiple transcript variants, but the full length nature of all the other variants but one has not been defined.
• Protein Interactions: SUMO3; UBC; LIN28A; PRKRA; TARBP2; EED; RNF2; TARDBP; SRPK2; WHSC1; KRAS; ESR1; BARD1; CAND1; CUL3; HDGF; STAU1; SRRM2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-DDX50 (ARP36497_T100) antibody is Catalog # AAP36497 (Previous Catalog # AAPP08552)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DDX50
• Uniprot ID: Q9BQ39
• Protein Name: ATP-dependent RNA helicase DDX50
• Sample Type Confirmation:

  DDX50 is supported by BioGPS gene expression data to be expressed in Jurkat

• Protein Accession #: NP_076950
• Purification: Protein A purified
• Nucleotide Accession #: NM_024045
• Tested Species Reactivity: Human
• Gene Symbol: DDX50
• Predicted Species Reactivity: Human, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Pig: 93%; Rabbit: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-DDX50 Antibody Titration: 2.5ug/ml
  ELISA Titer: 1:62500
  Positive Control: Jurkat cell lysateDDX50 is supported by BioGPS gene expression data to be expressed in Jurkat