DDX47 Antibody - N-terminal region (ARP36440_T100)

Data Sheet
 
Product Number ARP36440_T100
Product Page www.avivasysbio.com/ddx47-antibody-n-terminal-region-arp36440-t100.html
Name DDX47 Antibody - N-terminal region (ARP36440_T100)
Protein Size (# AA) 455 amino acids
Molecular Weight 50kDa
NCBI Gene Id 51202
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 47
Alias Symbols RRP3, E4-DBP, HQ0256, MSTP162
Peptide Sequence Synthetic peptide located within the following region: QLGWTKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Doorbar,J., et al., (2000) J. Virol. 74 (21), 10081-10095
Description of Target DDX47 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene can shuttle between the nucleus and the cytoplasm, and has an RNA-independent ATPase activity. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Protein Interactions UBC; EED; rev; PARK2; SRPK1; MLH1; KRAS; FN1; APP; EXOSC4; CAND1; PRNP; SUMO1; HDGF; SUMO2; HDAC5; SART3; Rrp1b;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DDX47 (ARP36440_T100) antibody
Blocking Peptide For anti-DDX47 (ARP36440_T100) antibody is Catalog # AAP36440 (Previous Catalog # AAPP08496)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human DDX47
Uniprot ID Q9H0S4
Protein Name Probable ATP-dependent RNA helicase DDX47
Protein Accession # NP_057439
Purification Protein A purified
Nucleotide Accession # NM_016355
Tested Species Reactivity Human
Gene Symbol DDX47
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 92%
Image 1
Human Jurkat
WB Suggested Anti-DDX47 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com