DDX41 Antibody - C-terminal region (ARP36438_T100)

• Product Number: ARP36438_T100
• Name: DDX41 Antibody - C-terminal region (ARP36438_T100)
• Protein Size (# AA): 622 amino acids
• Molecular Weight: 70 kDa
• NCBI Gene Id: 51428
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 41
• Alias Symbols: ABS, MPLPF
• Peptide Sequence: Synthetic peptide located within the following region: AIHEYLLLKGVEAVAIHGGKDQEERTKAIEAFREGKKDVLVATDVASKGL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Irion,U. et al., (1999) Curr. Biol. 9 (23), 1373-1381
• Description of Target: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. The function of this member has not been determined. Based on studies in Drosophila, the abstrakt gene is widely required during post-transcriptional gene expression.
• Protein Interactions: CEP70; SIAH1; CEP250; LIN28A; HDAC6; NKAP; UBD; CUL3; SUMO2; UBC; Ddx41; CHAF1A; USP36; RNPS1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-DDX41 (ARP36438_T100) antibody is Catalog # AAP36438 (Previous Catalog # AAPP08494)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DDX41
• Uniprot ID: Q9UJV9
• Protein Name: Probable ATP-dependent RNA helicase DDX41
• Sample Type Confirmation:

  DDX41 is supported by BioGPS gene expression data to be expressed in Jurkat

• Protein Accession #: NP_057306
• Purification: Protein A purified
• Nucleotide Accession #: NM_016222
• Tested Species Reactivity: Human
• Gene Symbol: DDX41
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 79%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-DDX41 Antibody Titration: 1.25ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Jurkat cell lysateDDX41 is supported by BioGPS gene expression data to be expressed in Jurkat