| Product Number |
ARP36242_T100 |
| Product Page |
www.avivasysbio.com/znf660-antibody-c-terminal-region-arp36242-t100.html |
| Name |
ZNF660 Antibody - C-terminal region (ARP36242_T100) |
| Protein Size (# AA) |
331 amino acids |
| Molecular Weight |
38kDa |
| NCBI Gene Id |
285349 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 660 |
| Peptide Sequence |
Synthetic peptide located within the following region: TFRQTSQVILHLRTHTKEKPYKCSECGKAYRYSSQLIQHQRKHNEEKETS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Strausberg R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
| Description of Target |
Located on chromosome 3, the ZNF660 gene encodes for zinc finger protein 660. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF660 (ARP36242_T100) antibody |
| Blocking Peptide |
For anti-ZNF660 (ARP36242_T100) antibody is Catalog # AAP36242 (Previous Catalog # AAPP07601) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF660 |
| Uniprot ID |
Q6AZW8 |
| Protein Name |
Zinc finger protein 660 |
| Protein Accession # |
NP_775929 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_173658 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF660 |
| Predicted Species Reactivity |
Human, Rat, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Horse: 100%; Human: 100%; Rabbit: 86%; Rat: 93% |
| Image 1 | Human HepG2
 | WB Suggested Anti-ZNF660 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate |
| | Image 2 | Human Skin
 | Human Skin |
|
|
