| Product Number |
ARP36191_P050 |
| Product Page |
www.avivasysbio.com/cbll2-antibody-n-terminal-region-arp36191-p050.html |
| Name |
CBLL2 Antibody - N-terminal region (ARP36191_P050) |
| Protein Size (# AA) |
425 amino acids |
| Molecular Weight |
49kDa |
| NCBI Gene Id |
158506 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Cbl proto-oncogene like 2 |
| Alias Symbols |
CT138, HAKAIL, ZNF645 |
| Peptide Sequence |
Synthetic peptide located within the following region: MNKMPAGEQECEYNKEGKYYSKGVKLVRKKKKIPGYRWGDIKINIIGEKD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Sugano,S. Unpublished (2002) |
| Description of Target |
This gene encodes a member of the zinc finger domain-containing protein family. This family member contains both a RING-type and a C2H2-type of zinc finger domain, and it may function as an E3 ubiquitin-protein ligase. Protein localization suggests a role in human sperm production and quality control. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CBLL2 (ARP36191_P050) antibody |
| Blocking Peptide |
For anti-CBLL2 (ARP36191_P050) antibody is Catalog # AAP36191 (Previous Catalog # AAPP07546) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF645 |
| Uniprot ID |
Q8N7E2 |
| Protein Name |
E3 ubiquitin-protein ligase CBLL2 |
| Publications |
Bai, G. et al. Promoter demethylation mediates the expression of ZNF645, a novel cancer/testis gene. BMB Rep. 43, 400-6 (2010). 20587329
Liu, Y.-Q. et al. Human RING finger protein ZNF645 is a novel testis-specific E3 ubiquitin ligase. Asian J. Androl. 12, 658-66 (2010). 20657603 |
| Protein Accession # |
NP_689790 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_152577 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CBLL2 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZNF645 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate |
|
|
