| Product Number |
ARP36179_P050 |
| Product Page |
www.avivasysbio.com/znf690-antibody-middle-region-arp36179-p050.html |
| Name |
ZNF690 Antibody - middle region (ARP36179_P050) |
| Protein Size (# AA) |
851 amino acids |
| Molecular Weight |
97kDa |
| NCBI Gene Id |
146050 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger and SCAN domain containing 29 |
| Alias Symbols |
ZNF690, Zfp690 |
| Peptide Sequence |
Synthetic peptide located within the following region: APVLFQSPRGFEAGFENEDNSKRDISEEVQLHRTLLARSERKIPRYLHQG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Dgany,O., et al., (2002) Am. J. Hum. Genet. 71 (6), 1467-1474 |
| Description of Target |
ZNF690 is a new candidate transcription factor. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZSCAN29 (ARP36179_P050) antibody |
| Blocking Peptide |
For anti-ZSCAN29 (ARP36179_P050) antibody is Catalog # AAP36179 (Previous Catalog # AAPP07534) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZNF690 |
| Uniprot ID |
Q8IWY8 |
| Protein Name |
Zinc finger and SCAN domain-containing protein 29 |
| Protein Accession # |
NP_689668 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_152455 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZSCAN29 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 91%; Dog: 82%; Horse: 91%; Human: 100%; Mouse: 92%; Pig: 85%; Rabbit: 91%; Rat: 77% |
| Image 1 | Human HepG2
 | WB Suggested Anti-ZNF690 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate |
|
|
