| Product Number |
ARP36170_P050 |
| Product Page |
www.avivasysbio.com/znf285a-antibody-middle-region-arp36170-p050.html |
| Name |
ZNF285A Antibody - middle region (ARP36170_P050) |
| Protein Size (# AA) |
590 amino acids |
| Molecular Weight |
68kDa |
| NCBI Gene Id |
26974 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 285 |
| Alias Symbols |
ZNF285A |
| Peptide Sequence |
Synthetic peptide located within the following region: PYEFHEWPMGCKQSSDLPRYQKVSSGDKPYKCKECGKGFRRSSSLHNHHR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Shannon,M., Genome Res. 13 (6A), 1097-1110 (2003) |
| Description of Target |
ZNF285A may be involved in transcriptional regulation. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF285 (ARP36170_P050) antibody |
| Blocking Peptide |
For anti-ZNF285 (ARP36170_P050) antibody is Catalog # AAP36170 (Previous Catalog # AAPP07525) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZNF285A |
| Uniprot ID |
Q96NJ3 |
| Protein Name |
Zinc finger protein 285 |
| Protein Accession # |
NP_689567 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_152354 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF285 |
| Predicted Species Reactivity |
Human, Dog |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 91%; Human: 100% |
| Image 1 | Human ACHN
 | WB Suggested Anti-ZNF285A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: ACHN cell lysate |
|
|
