CCNB3 Antibody - N-terminal region (ARP36087_T100)

Data Sheet
 
Product Number ARP36087_T100
Product Page www.avivasysbio.com/ccnb3-antibody-n-terminal-region-arp36087-t100.html
Name CCNB3 Antibody - N-terminal region (ARP36087_T100)
Protein Size (# AA) 291 amino acids
Molecular Weight 33kDa
NCBI Gene Id 85417
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Cyclin B3
Alias Symbols CYCB3
Peptide Sequence Synthetic peptide located within the following region: MLLPLPPQSSKPVPKKSQSSKIVPSHHDPSEKTGENCQTKISPSSLQESP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Nguyen,T.B., et al., (2002) J. Biol. Chem. 277 (44), 41960-41969
Description of Target CCNB3 belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event.This cyclin may associate with CDC2 and CDK2 kinases, and be required for proper spindle reorganization and restoration of the interphase nucleus.The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. Studies of similar genes in chick and Drosophila suggest that this cyclin may associate with CDC2 and CDK2 kinases, and be required for proper spindle reorganization and restoration of the interphase nucleus. Two transcript variants encoding different isoforms have been found for this gene.
Protein Interactions APP; CDK2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CCNB3 (ARP36087_T100) antibody
Blocking Peptide For anti-CCNB3 (ARP36087_T100) antibody is Catalog # AAP36087 (Previous Catalog # AAPP07415)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CCNB3
Uniprot ID Q5HYQ1
Protein Accession # NP_391990
Purification Protein A purified
Nucleotide Accession # NM_033670
Tested Species Reactivity Human
Gene Symbol CCNB3
Predicted Species Reactivity Human, Dog
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 82%; Human: 100%
Image 1
Human Jurkat
WB Suggested Anti-CCNB3 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com