Product Number |
ARP36087_T100 |
Product Page |
www.avivasysbio.com/ccnb3-antibody-n-terminal-region-arp36087-t100.html |
Name |
CCNB3 Antibody - N-terminal region (ARP36087_T100) |
Protein Size (# AA) |
291 amino acids |
Molecular Weight |
33kDa |
NCBI Gene Id |
85417 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Cyclin B3 |
Alias Symbols |
CYCB3 |
Peptide Sequence |
Synthetic peptide located within the following region: MLLPLPPQSSKPVPKKSQSSKIVPSHHDPSEKTGENCQTKISPSSLQESP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Nguyen,T.B., et al., (2002) J. Biol. Chem. 277 (44), 41960-41969 |
Description of Target |
CCNB3 belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event.This cyclin may associate with CDC2 and CDK2 kinases, and be required for proper spindle reorganization and restoration of the interphase nucleus.The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. Studies of similar genes in chick and Drosophila suggest that this cyclin may associate with CDC2 and CDK2 kinases, and be required for proper spindle reorganization and restoration of the interphase nucleus. Two transcript variants encoding different isoforms have been found for this gene. |
Protein Interactions |
APP; CDK2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CCNB3 (ARP36087_T100) antibody |
Blocking Peptide |
For anti-CCNB3 (ARP36087_T100) antibody is Catalog # AAP36087 (Previous Catalog # AAPP07415) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CCNB3 |
Uniprot ID |
Q5HYQ1 |
Protein Accession # |
NP_391990 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_033670 |
Tested Species Reactivity |
Human |
Gene Symbol |
CCNB3 |
Predicted Species Reactivity |
Human, Dog |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 82%; Human: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-CCNB3 Antibody Titration: 2.5ug/ml ELISA Titer: 1:1562500 Positive Control: Jurkat cell lysate |
|
|