| Product Number |
ARP36078_P050 |
| Product Page |
www.avivasysbio.com/znf607-antibody-middle-region-arp36078-p050.html |
| Name |
ZNF607 Antibody - middle region (ARP36078_P050) |
| Protein Size (# AA) |
696 amino acids |
| Molecular Weight |
81kDa |
| NCBI Gene Id |
84775 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 607 |
| Peptide Sequence |
Synthetic peptide located within the following region: KECGKGFTCRYQLTMHQRIYSGEKHYECKENGEAFSSGHQLTAPHTFESV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Isogai,T. Unpublished (2004) |
| Description of Target |
ZNF607 contains 12 C2H2-type zinc fingers and may be involved in transcriptional regulation. |
| Protein Interactions |
MTUS2; MDFI; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF607 (ARP36078_P050) antibody |
| Blocking Peptide |
For anti-ZNF607 (ARP36078_P050) antibody is Catalog # AAP36078 (Previous Catalog # AAPP07388) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZNF607 |
| Uniprot ID |
Q6ZMN2 |
| Protein Name |
cDNA FLJ16803 fis, clone TESTI4005500, weakly similar to Zinc finger protein 184 EMBL BAD18693.1 |
| Protein Accession # |
NP_116078 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_032689 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF607 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZNF607 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate |
|
|
