| Product Number |
ARP36077_T100 |
| Product Page |
www.avivasysbio.com/znf577-antibody-c-terminal-region-arp36077-t100.html |
| Name |
ZNF577 Antibody - C-terminal region (ARP36077_T100) |
| Protein Size (# AA) |
478 amino acids |
| Molecular Weight |
54kDa |
| NCBI Gene Id |
84765 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 577 |
| Peptide Sequence |
Synthetic peptide located within the following region: EKTHIRETAINSLTVEKPSSRSHTSLYMSELIQEQKTVNTVPIEMPSSGT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Quill,T.A., et al., Unpublished (2001) |
| Description of Target |
ZNF577 is a candidate transcription factor |
| Protein Interactions |
LYN; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF577 (ARP36077_T100) antibody |
| Blocking Peptide |
For anti-ZNF577 (ARP36077_T100) antibody is Catalog # AAP36077 (Previous Catalog # AAPP07387) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF577 |
| Uniprot ID |
Q9BSK1 |
| Protein Name |
Zinc finger protein 577 |
| Protein Accession # |
NP_116068 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_032679 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF577 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZNF577 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate |
|
|
