| Product Number |
ARP36019_T100 |
| Product Page |
www.avivasysbio.com/ebf2-antibody-c-terminal-region-arp36019-t100.html |
| Name |
EBF2 Antibody - C-terminal region (ARP36019_T100) |
| Protein Size (# AA) |
553 amino acids |
| Molecular Weight |
61kDa |
| NCBI Gene Id |
64641 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Early B-cell factor 2 |
| Alias Symbols |
COE2, OE-3, EBF-2, O/E-3 |
| Peptide Sequence |
Synthetic peptide located within the following region: VPRNPSQLPALSSSPAHSGMMGINSYGSQLGVSISESTQGNNQGYIRNTS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
EBF2 belongs to the conserved Olf/EBF family of helix-loop-helix transcription factors |
| Protein Interactions |
ZNF423; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-EBF2 (ARP36019_T100) antibody |
| Blocking Peptide |
For anti-EBF2 (ARP36019_T100) antibody is Catalog # AAP36019 (Previous Catalog # AAPP23592) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human EBF2 |
| Uniprot ID |
Q9HAK2 |
| Protein Accession # |
XP_944784 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
XM_939691 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
EBF2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-EBF2 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate |
|
|
