ZNF12 Antibody - N-terminal region (ARP35912_T100)

Data Sheet
 
Product Number ARP35912_T100
Product Page www.avivasysbio.com/znf12-antibody-n-terminal-region-arp35912-t100.html
Name ZNF12 Antibody - N-terminal region (ARP35912_T100)
Protein Size (# AA) 501 amino acids
Molecular Weight 58kDa
NCBI Gene Id 7559
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger protein 12
Alias Symbols KOX3, HZF11, GIOT-3, ZNF325
Peptide Sequence Synthetic peptide located within the following region: FLLQSYPDEVWQTDDLIERIQEEENKPSRQTVFIETLIEERGNVPGKTFD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Seite,P., et al., (1991) Hum. Genet. 86 (6), 585-590
Description of Target ZNF12 is a candidate transcription factor
Protein Interactions UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF12 (ARP35912_T100) antibody
Blocking Peptide For anti-ZNF12 (ARP35912_T100) antibody is Catalog # AAP35912 (Previous Catalog # AAPP07166)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF12
Uniprot ID P17014
Protein Name Zinc finger protein 12
Purification Protein A purified
Tested Species Reactivity Human
Gene Symbol ZNF12
Predicted Species Reactivity Human
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human HepG2
WB Suggested Anti-ZNF12 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
Image 2
Human Intestine
Human Intestine
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com