Product Number |
ARP35912_T100 |
Product Page |
www.avivasysbio.com/znf12-antibody-n-terminal-region-arp35912-t100.html |
Name |
ZNF12 Antibody - N-terminal region (ARP35912_T100) |
Protein Size (# AA) |
501 amino acids |
Molecular Weight |
58kDa |
NCBI Gene Id |
7559 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Zinc finger protein 12 |
Alias Symbols |
KOX3, HZF11, GIOT-3, ZNF325 |
Peptide Sequence |
Synthetic peptide located within the following region: FLLQSYPDEVWQTDDLIERIQEEENKPSRQTVFIETLIEERGNVPGKTFD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Seite,P., et al., (1991) Hum. Genet. 86 (6), 585-590 |
Description of Target |
ZNF12 is a candidate transcription factor |
Protein Interactions |
UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF12 (ARP35912_T100) antibody |
Blocking Peptide |
For anti-ZNF12 (ARP35912_T100) antibody is Catalog # AAP35912 (Previous Catalog # AAPP07166) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF12 |
Uniprot ID |
P17014 |
Protein Name |
Zinc finger protein 12 |
Purification |
Protein A purified |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF12 |
Predicted Species Reactivity |
Human |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-ZNF12 Antibody Titration: 1.25ug/ml ELISA Titer: 1:1562500 Positive Control: HepG2 cell lysate |
| Image 2 | Human Intestine
| Human Intestine |
|
|