| Product Number |
ARP35808_P050 |
| Product Page |
www.avivasysbio.com/znf266-antibody-n-terminal-region-arp35808-p050.html |
| Name |
ZNF266 Antibody - N-terminal region (ARP35808_P050) |
| Protein Size (# AA) |
549 amino acids |
| Molecular Weight |
62kDa |
| NCBI Gene Id |
10781 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 266 |
| Alias Symbols |
HZF1 |
| Peptide Sequence |
Synthetic peptide located within the following region: EESRTVQRGDFQASEWKVQLKTKELALQQDVLGEPTSSGIQMIGSHNGGE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Abrink,M., et al., (1995) DNA Cell Biol. 14 (2), 125-136 |
| Description of Target |
Located on chromosome 19, ZNF266 is part of the Kruppel-related zinc finger gene family. |
| Protein Interactions |
KRTAP10-3; KRTAP10-7; KRT40; TRIM41; CEP70; MDFI; KRTAP5-9; UBC; CDC37; SPRY2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF266 (ARP35808_P050) antibody |
| Blocking Peptide |
For anti-ZNF266 (ARP35808_P050) antibody is Catalog # AAP35808 (Previous Catalog # AAPP07060) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF266 |
| Uniprot ID |
Q14584 |
| Protein Name |
Zinc finger protein 266 |
| Protein Accession # |
NP_932175 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_198058 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF266 |
| Predicted Species Reactivity |
Human |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Cerebellum
 | Human Cerebellum |
| | Image 2 | Human HepG2
 | WB Suggested Anti-ZNF266 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate |
|
|
