ZNF239 Antibody - N-terminal region (ARP35784_P050)

• Product Number: ARP35784_P050
• Name: ZNF239 Antibody - N-terminal region (ARP35784_P050)
• Protein Size (# AA): 458 amino acids
• Molecular Weight: 52kDa
• NCBI Gene Id: 8187
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Zinc finger protein 239
• Alias Symbols: MOK2, HOK-2
• Peptide Sequence: Synthetic peptide located within the following region: SRNRDSVMTLQSGCFENIESETYLPLKVSSQIDTQDSSVKFCKNEPQDHQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Dreuillet,C., et al., (2002) Nucleic Acids Res. 30 (21), 4634-4642
• Description of Target: MOK2 proteins are DNA- and RNA-binding proteins that are mainly associated with nuclear RNP components, including the nucleoli and extranucleolar structures (Arranz et al., 1997 [PubMed 9121460]).[supplied by OMIM].
• Protein Interactions: CEP70; LMNA;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZNF239 (ARP35784_P050) antibody is Catalog # AAP35784 (Previous Catalog # AAPP07036)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF239
• Uniprot ID: Q16600
• Protein Name: Zinc finger protein 239
• Protein Accession #: NP_005665
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005674
• Tested Species Reactivity: Human
• Gene Symbol: ZNF239
• Predicted Species Reactivity: Human, Dog
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Dog: 83%; Human: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-ZNF239 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Jurkat cell lysate