| Product Number |
ARP35763_P050 |
| Product Page |
www.avivasysbio.com/dlx6-antibody-c-terminal-region-arp35763-p050.html |
| Name |
Dlx6 Antibody - C-terminal region (ARP35763_P050) |
| Protein Size (# AA) |
268 amino acids |
| Molecular Weight |
30kDa |
| NCBI Gene Id |
500023 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Distal-less homeobox 6 |
| Alias Symbols |
RGD1561539 |
| Peptide Sequence |
Synthetic peptide located within the following region: FQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGSNPHES |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Dlx6 (ARP35763_P050) antibody |
| Blocking Peptide |
For anti-Dlx6 (ARP35763_P050) antibody is Catalog # AAP35763 (Previous Catalog # AAPP07015) |
| Publications |
Li, H. et al. Expression and function of Dlx genes in the osteoblast lineage. Dev. Biol. 316, 458-70 (2008). 18280462 |
| Protein Accession # |
XP_575377 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
XM_575377 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Dlx6 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92% |
| Image 1 | Rat Muscle
 | WB Suggested Anti-Dlx6 Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Muscle |
|
|
