SOX14 Antibody - middle region (ARP35712_T100)

Data Sheet
 
Product Number ARP35712_T100
Product Page www.avivasysbio.com/sox14-antibody-middle-region-arp35712-t100.html
Name SOX14 Antibody - middle region (ARP35712_T100)
Protein Size (# AA) 240 amino acids
Molecular Weight 26kDa
NCBI Gene Id 8403
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name SRY (sex determining region Y)-box 14
Alias Symbols SOX28
Peptide Sequence Synthetic peptide located within the following region: HTLATGALPYASTLGYQNGAFGSLSCPSQHTHTHPSPTNPGYVVPCNCTA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Schepers,G.E., et al., (2002) Dev. Cell 3 (2), 167-170
Description of Target This intronless gene, SOX14, encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. Mutations in the SOX14 gene are suggested to be responsible for the limb defects associated with blepharophimosis, ptosis, epicanthus inversus syndrome (BPES) and Mobius syndrome.
Protein Interactions NAIF1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SOX14 (ARP35712_T100) antibody
Blocking Peptide For anti-SOX14 (ARP35712_T100) antibody is Catalog # AAP35712 (Previous Catalog # AAPP06958)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SOX14
Uniprot ID O95416
Protein Name Transcription factor SOX-14
Protein Accession # NP_004180
Purification Protein A purified
Nucleotide Accession # NM_004189
Tested Species Reactivity Human
Gene Symbol SOX14
Predicted Species Reactivity Human, Mouse, Rat, Cow, Goat, Guinea Pig, Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Goat: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 79%
Image 1
Human HepG2
WB Suggested Anti-SOX14 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com