| Product Number |
ARP35579_P050 |
| Product Page |
www.avivasysbio.com/cacnb1-antibody-middle-region-arp35579-p050.html |
| Name |
CACNB1 Antibody - middle region (ARP35579_P050) |
| Protein Size (# AA) |
523 amino acids |
| Molecular Weight |
58kDa |
| Subunit |
beta-1 |
| NCBI Gene Id |
782 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Calcium channel, voltage-dependent, beta 1 subunit |
| Alias Symbols |
CAB1, CCHLB1, CACNLB1 |
| Peptide Sequence |
Synthetic peptide located within the following region: TRRPTPPASGNEMTNLAFELDPLELEEEEAELGEQSGSAKTSVSSVTTPP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Foell,J.D., (2004) (er) Physiol. Genomics 17 (2), 183-200 |
| Description of Target |
The protein encoded by CACNB1 belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation.The protein encoded by this gene belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified. |
| Protein Interactions |
SRPK1; APP; ATN1; NEDD4L; UBC; REM1; DYNLL1; CACNA1A; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CACNB1 (ARP35579_P050) antibody |
| Blocking Peptide |
For anti-CACNB1 (ARP35579_P050) antibody is Catalog # AAP35579 (Previous Catalog # AAPP23764) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CACNB1 |
| Uniprot ID |
Q02641-2 |
| Protein Name |
Voltage-dependent L-type calcium channel subunit beta-1 |
| Protein Accession # |
NP_954855 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_199247 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CACNB1 |
| Predicted Species Reactivity |
Human, Mouse, Cow, Guinea Pig, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 86%; Rabbit: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-CACNB1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate |
| | Image 2 | Human kidney
 | Human kidney |
|
|
