P2RX7 Antibody - middle region (ARP35517_P050)

• Product Number: ARP35517_P050
• Name: P2RX7 Antibody - middle region (ARP35517_P050)
• Protein Size (# AA): 595 amino acids
• Molecular Weight: 69kDa
• NCBI Gene Id: 5027
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Purinergic receptor P2X, ligand-gated ion channel, 7
• Alias Symbols: P2X7
• Peptide Sequence: Synthetic peptide located within the following region: VKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The product P2RX7 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. Activation of this nuclear receptor by ATP in the cytoplasm may be a mechanism by which cellular activity can be coupled to changes in gene expression.
• Protein Interactions: KRTAP10-8; KRT31; TM9SF1; CASK; EFNB3; EMP3; PANX1; SVIL; ACTB;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-P2RX7 (ARP35517_P050) antibody is Catalog # AAP35517 (Previous Catalog # AAPP07289)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human P2RX7
• Uniprot ID: Q99572
• Protein Name: P2X purinoceptor 7
• Protein Accession #: NP_803176
• Purification: Affinity Purified
• Nucleotide Accession #: NM_177427
• Tested Species Reactivity: Human
• Gene Symbol: P2RX7
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 79%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 79%; Rabbit: 90%; Rat: 85%
• Image 1: Human Heart
  
  WB Suggested Anti-P2RX7 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Human heart
• Image 2: HEK-293
  
  WB Suggested Anti-P2RX7 Antibody
  Positive Control: Lane 1: 50ug mock transfected HEK-293Lane 2: 50ug hP2X7 transfected HEK-293Lane 3: 50ug mP2X7 transfected HEK-293Lane 4: 50ug rP2X7 transfected HEK-293
  Primary Antibody Dilution : 1:625
  Secondary Antibody : Anti-rabbit-HRP
  Secondry Antibody Dilution : 1:1000
  Submitted by: Ronald Sluyter, School of Biological Sciences, University of Wollongong