KCNIP2 Antibody - N-terminal region (ARP35488_P050)

• Product Number: ARP35488_P050
• Name: KCNIP2 Antibody - N-terminal region (ARP35488_P050)
• Protein Size (# AA): 184 amino acids
• Molecular Weight: 21kDa
• NCBI Gene Id: 30819
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Kv channel interacting protein 2
• Alias Symbols: KCHIP2
• Peptide Sequence: Synthetic peptide located within the following region: PEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Kim,L.A., et al., (2004) J. Biol. Chem. 279 (7), 5549-5554
• Description of Target: The KCNIP2 gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium.
• Protein Interactions: KCND2; KCNIP1; KCNIP2; KCNE4; KCND3; KCNIP4;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-KCNIP2 (ARP35488_P050) antibody is Catalog # AAP35488 (Previous Catalog # AAPP06728)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KCNIP2
• Uniprot ID: Q9NS61-9
• Protein Name: Kv channel-interacting protein 2
• Sample Type Confirmation:

  KCNIP2 is supported by BioGPS gene expression data to be expressed in Jurkat

• Protein Accession #: NP_775289
• Purification: Affinity Purified
• Nucleotide Accession #: NM_173197
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: KCNIP2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
• Image 1: Human Jurkat
  
  WB Suggested Anti-KCNIP2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Jurkat cell lysateKCNIP2 is supported by BioGPS gene expression data to be expressed in Jurkat
• Image 2: Mouse Pancreas
  
  Host: Mouse
  Target Name: KCNIP2
  Sample Tissue: Mouse Pancreas
  Antibody Dilution: 1ug/ml
• Image 3: Human Heart
  
  Rabbit Anti-KCNIP2 antibody
  Catalog Number: ARP35488
  Formalin Fixed Paraffin Embedded Tissue: Human Heart
  Primary antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20x
  Exposure Time: 0.5-2.0sec