Product Number |
ARP35421_T100 |
Product Page |
www.avivasysbio.com/kctd18-antibody-n-terminal-region-arp35421-t100.html |
Name |
KCTD18 Antibody - N-terminal region (ARP35421_T100) |
Protein Size (# AA) |
426 amino acids |
Molecular Weight |
47kDa |
NCBI Gene Id |
130535 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Potassium channel tetramerisation domain containing 18 |
Alias Symbols |
6530404F10Rik |
Peptide Sequence |
Synthetic peptide located within the following region: LHYLNTSGASCESRIIGVYATKTDGTDAIEKQLGGRIHSKGIFKREAGNN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45 |
Description of Target |
The function of Anti-KCTD18 has not yet been determined. |
Protein Interactions |
APP; COPS5; COPS6; CUL3; UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-KCTD18 (ARP35421_T100) antibody |
Blocking Peptide |
For anti-KCTD18 (ARP35421_T100) antibody is Catalog # AAP35421 (Previous Catalog # AAPP06659) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human KCTD18 |
Uniprot ID |
Q6PI47 |
Protein Name |
BTB/POZ domain-containing protein KCTD18 |
Protein Accession # |
NP_689600 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_152387 |
Tested Species Reactivity |
Human |
Gene Symbol |
KCTD18 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 93% |
Image 1 | Human Jurkat
| WB Suggested Anti-KCTD18 Antibody Titration: 5.0ug/ml ELISA Titer: 1:312500 Positive Control: Jurkat cell lysate |
|
|