KCTD18 Antibody - N-terminal region (ARP35421_T100)

Data Sheet
 
Product Number ARP35421_T100
Product Page www.avivasysbio.com/kctd18-antibody-n-terminal-region-arp35421-t100.html
Name KCTD18 Antibody - N-terminal region (ARP35421_T100)
Protein Size (# AA) 426 amino acids
Molecular Weight 47kDa
NCBI Gene Id 130535
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Potassium channel tetramerisation domain containing 18
Alias Symbols 6530404F10Rik
Peptide Sequence Synthetic peptide located within the following region: LHYLNTSGASCESRIIGVYATKTDGTDAIEKQLGGRIHSKGIFKREAGNN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45
Description of Target The function of Anti-KCTD18 has not yet been determined.
Protein Interactions APP; COPS5; COPS6; CUL3; UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KCTD18 (ARP35421_T100) antibody
Blocking Peptide For anti-KCTD18 (ARP35421_T100) antibody is Catalog # AAP35421 (Previous Catalog # AAPP06659)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human KCTD18
Uniprot ID Q6PI47
Protein Name BTB/POZ domain-containing protein KCTD18
Protein Accession # NP_689600
Purification Protein A purified
Nucleotide Accession # NM_152387
Tested Species Reactivity Human
Gene Symbol KCTD18
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 93%
Image 1
Human Jurkat
WB Suggested Anti-KCTD18 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com