KCNK10 Antibody - N-terminal region (ARP35399_T100)

Data Sheet
 
Product Number ARP35399_T100
Product Page www.avivasysbio.com/kcnk10-antibody-n-terminal-region-arp35399-t100.html
Name KCNK10 Antibody - N-terminal region (ARP35399_T100)
Protein Size (# AA) 538 amino acids
Molecular Weight 59kDa
NCBI Gene Id 54207
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Potassium channel, subfamily K, member 10
Alias Symbols TREK2, TREK-2, K2p10.1, PPP1R97
Peptide Sequence Synthetic peptide located within the following region: VVAIFVVVVVYLVTGGLVFRALEQPFESSQKNTIALEKAEFLRDHVCVSP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Gu,W., et al., (2002) J. Physiol. (Lond.) 539 (Pt 3), 657-668
Description of Target KCNK10 encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The message for this gene is highly expressed in the kidney and pancreas. This channel is an open rectifier which primarily passes outward current under physiological K+ concentrations. The protein is stimulated strongly by arachidonic acid and to a lesser degree by membrane stretching, intracellular acidification, and general anaesthetics. Three transcript variants have been identified for this gene.
Protein Interactions PPP1CA; UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KCNK10 (ARP35399_T100) antibody
Blocking Peptide For anti-KCNK10 (ARP35399_T100) antibody is Catalog # AAP35399 (Previous Catalog # AAPP06637)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human KCNK10
Uniprot ID P57789
Protein Name Potassium channel subfamily K member 10
Protein Accession # NP_066984
Purification Protein A purified
Nucleotide Accession # NM_021161
Tested Species Reactivity Human
Gene Symbol KCNK10
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Image 1
Human HepG2
WB Suggested Anti-KCNK10 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com