GABRQ Antibody - N-terminal region (ARP35283_P050)

• Product Number: ARP35283_P050
• Name: GABRQ Antibody - N-terminal region (ARP35283_P050)
• Protein Size (# AA): 632 amino acids
• Molecular Weight: 72kDa
• Subunit: theta
• NCBI Gene Id: 55879
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Gamma-aminobutyric acid (GABA) A receptor, theta
• Alias Symbols: THETA
• Peptide Sequence: Synthetic peptide located within the following region: KFHFEFSSAVPEVVLNLFNCKNCANEAVVQKILDRVLSRYDVRLRPNFGG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Sinkkonen,S.T., et al., (2000) J. Neurosci. 20 (10), 3588-3595
• Description of Target: The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, theta subunit. GABRQ gene is mapped to chromosome Xq28 in a cluster including the genes encoding the alpha 3 and epsilon subunits of the same receptor. This gene location is also the candidate region of 2 different neurologic diseases:early-onset parkinsonism (Waisman syndrome) and X-linked mental retardation (MRX3).The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, theta subunit. It is mapped to chromosome Xq28 in a cluster including the genes encoding the alpha 3 and epsilon subunits of the same receptor. This gene location is also the candidate region of 2 different neurologic diseases: early-onset parkinsonism (Waisman syndrome) and X-linked mental retardation (MRX3).
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-GABRQ (ARP35283_P050) antibody is Catalog # AAP35283 (Previous Catalog # AAPP06521)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GABRQ
• Uniprot ID: Q9UN88
• Protein Name: Gamma-aminobutyric acid receptor subunit theta
• Publications:

  Fatemi, S. H., Folsom, T. D., Rooney, R. J. & Thuras, P. D. mRNA and protein expression for novel GABAA receptors θ and ρ2 are altered in schizophrenia and mood disorders relevance to FMRP-mGluR5 signaling pathway. Transl. Psychiatry 3, e271 (2013). 23778581

• Protein Accession #: NP_061028
• Purification: Affinity Purified
• Nucleotide Accession #: NM_018558
• Tested Species Reactivity: Human
• Gene Symbol: GABRQ
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 87%; Dog: 87%; Guinea Pig: 80%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
• Image 1: Human Stomach Tumor
  
  Host: Rabbit
  Target Name: GABRQ
  Sample Tissue: Human Stomach Tumor
  Antibody Dilution: 1.0ug/ml