ACCN3 Antibody - N-terminal region (ARP35152_T100)

Data Sheet
 
Product Number ARP35152_T100
Product Page www.avivasysbio.com/accn3-antibody-n-terminal-region-arp35152-t100.html
Name ACCN3 Antibody - N-terminal region (ARP35152_T100)
Protein Size (# AA) 531 amino acids
Molecular Weight 58kDa
NCBI Gene Id 9311
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Acid-sensing (proton-gated) ion channel 3
Alias Symbols ACCN3, TNaC1, DRASIC, SLNAC1
Peptide Sequence Synthetic peptide located within the following region: VATFLYQVAERVRYYREFHHQTALDERESHRLIFPAVTLCNINPLRRSRL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Jones,N.G., et al., (2004) J. Neurosci. 24(48), 10974-9
Description of Target ACCN3 encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, two hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. ACCN3 encodes a member that is an acid sensor and may play an important role in the detection of lasting pH changes. In addition, a heteromeric association between this member and ACCN1 has been observed as proton-gated channels sensitive to gadolinium.
Protein Interactions ASIC3; LIN7B; GOPC; INADL; DLG4; MAGI1; ASIC2; STOM; CSNK2A1; PRKACA; STOML1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ASIC3 (ARP35152_T100) antibody
Blocking Peptide For anti-ASIC3 (ARP35152_T100) antibody is Catalog # AAP35152 (Previous Catalog # AAPP06382)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ACCN3
Uniprot ID Q9UHC3
Protein Name Acid-sensing ion channel 3
Protein Accession # NP_004760
Purification Protein A purified
Nucleotide Accession # NM_004769
Tested Species Reactivity Human
Gene Symbol ASIC3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 80%; Dog: 80%; Guinea Pig: 80%; Horse: 80%; Human: 100%; Mouse: 87%; Pig: 87%; Rabbit: 87%; Rat: 87%
Image 1
Human kidney
Human kidney
Image 2
Human Fetal Lung
Host: Rabbit
Target Name: ACCN3
Sample Tissue: Human Fetal Lung
Antibody Dilution: 1.0ug/ml
Image 3
Hela, HepG2
Host: Rabbit
Target: ASIC3
Positive control (+): Hela (HL)
Negative control (-): HepG2 (HG)
Antibody concentration: 2.5ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com