CUL5 Antibody - C-terminal region (ARP35127_T100)

Data Sheet
 
Product Number ARP35127_T100
Product Page www.avivasysbio.com/cul5-antibody-c-terminal-region-arp35127-t100.html
Name CUL5 Antibody - C-terminal region (ARP35127_T100)
Protein Size (# AA) 780 amino acids
Molecular Weight 86kDa
NCBI Gene Id 8065
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Cullin 5
Alias Symbols CUL-5, VACM1, VACM-1
Peptide Sequence Synthetic peptide located within the following region: VNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Burnatowska-Hledin,M.A., et al., (2004) Biochem. Biophys. Res. Commun. 319 (3), 817-825
Description of Target CUL5 encodes a protein that is involved in the regulation of cellular growth and promotes vif ubiquination.
Protein Interactions CCNDBP1; CUL3; RNF7; NOS2; NEDD4; GOLGA2; UBC; TCEB2; TCEB1; CBFB; vif; DCUN1D2; DCUN1D1; HIV2gp2; NEDD8; ASB13; ASB4; ASB1; ASB16; ASB3; ASB18; ASB14; ASB15; ASB9; ASB8; ASB7; ASB6; ASB5; ASB11; ASB10; RNF2; SAE1; PDE12; UNC13D; HIST1H1B; SHMT2; UBQLN2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CUL5 (ARP35127_T100) antibody
Blocking Peptide For anti-CUL5 (ARP35127_T100) antibody is Catalog # AAP35127 (Previous Catalog # AAPP08409)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CUL5
Uniprot ID Q93034
Protein Name Cullin-5
Protein Accession # NP_003469
Purification Protein A purified
Nucleotide Accession # NM_003478
Tested Species Reactivity Human, Mouse
Gene Symbol CUL5
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human HepG2
WB Suggested Anti-CUL5 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Image 2
Mouse Testis
Host: Mouse
Target Name: CUL5
Sample Tissue: Mouse Testis
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com