website statistics
Product Datasheet: ARP35127_T100 - CUL5 antibody - C-terminal region (ARP35127_T100) - Aviva Systems Biology
 
CUL5 antibody - C-terminal region (ARP35127_T100)
Data Sheet
 
Product Number ARP35127_T100
Product Page www.avivasysbio.com/cul5-antibody-c-terminal-region-arp35127-t100.html
Product Name CUL5 antibody - C-terminal region (ARP35127_T100)
Size 100 ul
Gene Symbol CUL5
Alias Symbols VACM1, VACM-1
Protein Size (# AA) 780 amino acids
Molecular Weight 86kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 8065
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Cullin 5
Description This is a rabbit polyclonal antibody against CUL5. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: VNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHH
Target Reference Burnatowska-Hledin,M.A., et al., (2004) Biochem. Biophys. Res. Commun. 319 (3), 817-825
Description of Target CUL5 encodes a protein that is involved in the regulation of cellular growth and promotes vif ubiquination.
Protein Interactions CCNDBP1; CUL3; RNF7; NOS2; NEDD4; GOLGA2; UBC; TCEB2; TCEB1; CBFB; vif; DCUN1D2; DCUN1D1; HIV2gp2; NEDD8; ASB13; ASB4; ASB1; ASB16; ASB3; ASB18; ASB14; ASB15; ASB9; ASB8; ASB7; ASB6; ASB5; ASB11; ASB10; RNF2; SAE1; PDE12; UNC13D; HIST1H1B; SHMT2; UBQLN2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-CUL5 (ARP35127_T100) antibody is Catalog # AAP35127 (Previous Catalog # AAPP08409)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CUL5
Complete computational species homology data Anti-CUL5 (ARP35127_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CUL5.
Swissprot Id Q93034
Protein Name Cullin-5
Protein Accession # NP_003469
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CUL5.
Nucleotide Accession # NM_003478
Replacement Item This antibody may replace item sc-12371 from Santa Cruz Biotechnology.
Conjugation Options

ARP35127_T100-FITC Conjugated

ARP35127_T100-HRP Conjugated

ARP35127_T100-Biotin Conjugated

CB Replacement sc-12371; sc-13014; sc-373822; sc-5325
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human HepG2
WB Suggested Anti-CUL5 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Image 2
Mouse Testis

Host: Mouse
Target Name: CUL5
Sample Tissue: Mouse Testis
Antibody Dilution: 1ug/ml

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com