| Product Number |
ARP34989_P050 |
| Product Page |
www.avivasysbio.com/gabrb2-antibody-n-terminal-region-arp34989-p050.html |
| Name |
GABRB2 Antibody - N-terminal region (ARP34989_P050) |
| Protein Size (# AA) |
474 amino acids |
| Molecular Weight |
55kDa |
| Subunit |
beta-2 |
| NCBI Gene Id |
2561 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Gamma-aminobutyric acid (GABA) A receptor, beta 2 |
| Alias Symbols |
DEE92, ICEE2 |
| Peptide Sequence |
Synthetic peptide located within the following region: HPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYW |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Yu,Z., et al., (2006) Clin. Biochem. 39 (3), 210-218 |
| Description of Target |
The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. GABRB2 encodes GABA A receptor, beta 2 subunit. |
| Protein Interactions |
UBC; UBQLN1; TRAK2; ARFGEF2; PRKCB; PPP3CA; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GABRB2 (ARP34989_P050) antibody |
| Blocking Peptide |
For anti-GABRB2 (ARP34989_P050) antibody is Catalog # AAP34989 (Previous Catalog # AAPP06216) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GABRB2 |
| Uniprot ID |
P47870 |
| Protein Name |
Gamma-aminobutyric acid receptor subunit beta-2 |
| Protein Accession # |
NP_000804 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000813 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GABRB2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-GABRB2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate |
|
|
