Product Number |
ARP34970_T100 |
Product Page |
www.avivasysbio.com/chrnb2-antibody-middle-region-arp34970-t100.html |
Name |
CHRNB2 Antibody - middle region (ARP34970_T100) |
Protein Size (# AA) |
502 amino acids |
Molecular Weight |
57kDa |
Subunit |
beta-2 |
NCBI Gene Id |
1141 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Cholinergic receptor, nicotinic, beta 2 (neuronal) |
Alias Symbols |
EFNL3, nAChRB2 |
Peptide Sequence |
Synthetic peptide located within the following region: CKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Hales,T.G., (2006) J. Biol. Chem. 281 (12), 8062-8071 |
Description of Target |
Mutations in nAChRs are found in a rare form of nocturnal frontal lobe epilepsy . Previously, some nAChR mutations have been described that are associated with additional neurological features such as psychiatric disorders or cognitive defects. A new CHRNB2 mutation located in transmembrane region 3 (M3), outside the known ADNFLE mutation cluster. The CHRNB2 mutation I312M, which occurred de novo in twins, markedly increases the receptor's sensitivity to acetylcholine. Phenotypically, the mutation is associated not only with typical ADNFLE, but also with distinct deficits in memory. The cognitive problems are most obvious in tasks requiring the organization and storage of verbal information. |
Protein Interactions |
CRELD2; CHRNA4; CHRNA2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CHRNB2 (ARP34970_T100) antibody |
Blocking Peptide |
For anti-CHRNB2 (ARP34970_T100) antibody is Catalog # AAP34970 (Previous Catalog # AAPP23870) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CHRNB2 |
Uniprot ID |
P17787 |
Protein Name |
Neuronal acetylcholine receptor subunit beta-2 |
Sample Type Confirmation |
CHRNB2 is supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_000739 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_000748 |
Tested Species Reactivity |
Human |
Gene Symbol |
CHRNB2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93% |
Image 1 | Human Jurkat
| WB Suggested Anti-CHRNB2 Antibody Titration: 2.5ug/ml Positive Control: Jurkat cell lysateCHRNB2 is supported by BioGPS gene expression data to be expressed in Jurkat |
|
Image 2 | Human kidney
| Human kidney |
|