| Product Number |
ARP34839_P050 |
| Product Page |
www.avivasysbio.com/znf258-antibody-middle-region-arp34839-p050.html |
| Name |
ZNF258 Antibody - middle region (ARP34839_P050) |
| Protein Size (# AA) |
723 amino acids |
| Molecular Weight |
79kDa |
| NCBI Gene Id |
9204 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger, MYM-type 6 |
| Alias Symbols |
MYM, ZBED7, ZNF258, Buster2, ZNF198L4 |
| Peptide Sequence |
Synthetic peptide located within the following region: TPVITSVMSLAKIPATLSTGNTNSVLKGAVTKEAAKIIQDESTQEDAMKF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Smedley,D., et al., (1999) Genomics 60 (2), 244-247 |
| Description of Target |
ZNF258 is part of a novel, putative, zinc-binding motif (MYM) family which encodes proteins that maintain the repeats of the MYM motif. |
| Protein Interactions |
SUMO2; KLHL13; CDK9; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZMYM6 (ARP34839_P050) antibody |
| Blocking Peptide |
For anti-ZMYM6 (ARP34839_P050) antibody is Catalog # AAP34839 (Previous Catalog # AAPP06048) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZNF258 |
| Uniprot ID |
O95789 |
| Protein Name |
Zinc finger MYM-type protein 6 |
| Sample Type Confirmation |
There is BioGPS gene expression data showing that ZMYM6 is expressed in Jurkat |
| Protein Accession # |
NP_009098 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_007167 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZMYM6 |
| Predicted Species Reactivity |
Human, Dog, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 91%; Horse: 79%; Human: 100%; Rabbit: 85% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZNF258 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that ZMYM6 is expressed in Jurkat |
| | Image 2 | Human kidney
 | Human kidney |
|
|
