Product Number |
ARP34806_T100 |
Product Page |
www.avivasysbio.com/znf627-antibody-n-terminal-region-arp34806-t100.html |
Name |
ZNF627 Antibody - N-terminal region (ARP34806_T100) |
Protein Size (# AA) |
461 amino acids |
Molecular Weight |
53kDa |
NCBI Gene Id |
199692 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Zinc finger protein 627 |
Peptide Sequence |
Synthetic peptide located within the following region: GKQWEDQNIEDPFKIPRRNISHIPERLCESKEGGQGEETFSQIPDGILNK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Isogai,T. Unpublished (2002) |
Description of Target |
ZNF627 is a new candidate transcription factor |
Protein Interactions |
CCNDBP1; UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF627 (ARP34806_T100) antibody |
Blocking Peptide |
For anti-ZNF627 (ARP34806_T100) antibody is Catalog # AAP34806 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF627 |
Uniprot ID |
Q7L945 |
Protein Name |
Zinc finger protein 627 |
Protein Accession # |
NP_660338 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_145295 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF627 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-ZNF627 Antibody Titration: 1.25 ug/ml Positive Control: Jurkat Whole Cell |
|
|