| Product Number |
ARP34603_P050 |
| Product Page |
www.avivasysbio.com/dmtf1-antibody-n-terminal-region-arp34603-p050.html |
| Name |
DMTF1 Antibody - N-terminal region (ARP34603_P050) |
| Protein Size (# AA) |
760 amino acids |
| Molecular Weight |
84kDa |
| NCBI Gene Id |
9988 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
cyclin D binding myb like transcription factor 1 |
| Alias Symbols |
DMP1, DMTF, MRUL, hDMP1 |
| Peptide Sequence |
Synthetic peptide located within the following region: LRMYDDRNHVGKYTPEEIEKLKELRIKHGNDWATIGAALGRSASSVKDRC |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Tschan,M.P., (2008) Leukemia 22 (5), 1087-1090 |
| Description of Target |
This gene encodes a transcription factor that contains a cyclin D-binding domain, three central Myb-like repeats, and two flanking acidic transactivation domains at the N- and C-termini. The encoded protein is induced by the oncogenic Ras signaling pathway and functions as a tumor suppressor by activating the transcription of ARF and thus the ARF-p53 pathway to arrest cell growth or induce apoptosis. It also activates the transcription of aminopeptidase N and may play a role in hematopoietic cell differentiation. The transcriptional activity of this protein is regulated by binding of D-cyclins. This gene is hemizygously deleted in approximately 40% of human non-small-cell lung cancer and is a potential prognostic and gene-therapy target for non-small-cell lung cancer. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Protein Interactions |
SRA1; TP53; ATF7IP; CCND1; CCND3; CCND2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-DMTF1 (ARP34603_P050) antibody |
| Blocking Peptide |
For anti-DMTF1 (ARP34603_P050) antibody is Catalog # AAP34603 (Previous Catalog # AAPP05785) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human DMTF1 |
| Uniprot ID |
Q9Y222 |
| Protein Name |
cyclin-D-binding Myb-like transcription factor 1 |
| Protein Accession # |
NP_066968 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_021145 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
DMTF1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
| Image 1 | Human PANC1
 | WB Suggested Anti-DMTF1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: PANC1 cell lysate |
|
|
