| Product Number |
ARP34468_T100 |
| Product Page |
www.avivasysbio.com/mier1-antibody-middle-region-arp34468-t100.html |
| Name |
MIER1 Antibody - middle region (ARP34468_T100) |
| Protein Size (# AA) |
536 amino acids |
| Molecular Weight |
49kDa |
| NCBI Gene Id |
57708 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Mesoderm induction early response 1 homolog (Xenopus laevis) |
| Alias Symbols |
ER1, MI-ER1 |
| Peptide Sequence |
Synthetic peptide located within the following region: RRTGDEKGVEAIPEGSHIKDNEQALYELVKCNFDTEEALRRLRF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Paterno, G.D., et al., (1998) Gene 222 (1), 77-82 |
| Description of Target |
The association of hMI-ER1 with Sp1 represents a novel mechanism for the negative regulation of Sp1 target promoters. Results demonstrate that alternate use of a facultative intron regulates the subcellular localization of hMI-ER1 proteins and this may have important implications for hMI-ER1 function in the regulation of transcription. Repressor activity is due to interaction and recruitment of a trichostatin A-sensitive histone deacetylase 1 (HDAC1). |
| Protein Interactions |
TMEM171; SOX2; HDAC2; HDAC1; EHMT2; CDYL; TUBB1; APP; ELAVL1; UBC; CREBBP; SP1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MIER1 (ARP34468_T100) antibody |
| Blocking Peptide |
For anti-MIER1 (ARP34468_T100) antibody is Catalog # AAP34468 (Previous Catalog # AAPY00430) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human MIER1 |
| Uniprot ID |
Q8NES5 |
| Protein Name |
Mesoderm induction early response protein 1 |
| Protein Accession # |
NP_065999 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_020948 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MIER1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-MIER1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate |
|
