| Product Number |
ARP34379_T100 |
| Product Page |
www.avivasysbio.com/elk4-antibody-c-terminal-region-arp34379-t100.html |
| Name |
ELK4 Antibody - C-terminal region (ARP34379_T100) |
| Protein Size (# AA) |
431 amino acids |
| Molecular Weight |
47kDa |
| NCBI Gene Id |
2005 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
ELK4, ETS-domain protein (SRF accessory protein 1) |
| Alias Symbols |
SAP1 |
| Peptide Sequence |
Synthetic peptide located within the following region: PVAPLSPARLQGANTLFQFPSVLNSHGPFTLSGLDGPSTPGPFSPDLQKT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Mo,Y., et al., (2001) J. Mol. Biol. 314 (3), 495-506 |
| Description of Target |
The ELK4 gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by ELK4 is phosphorylated by the kinases, MAPK1 and MAPK8. |
| Protein Interactions |
MAPK8; MAPK3; ELAVL1; ID1; MAPK11; MAPK7; SRF; ID2; ID3; FOS; BRCA1; MAPK14; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ELK4 (ARP34379_T100) antibody |
| Blocking Peptide |
For anti-ELK4 (ARP34379_T100) antibody is Catalog # AAP34379 (Previous Catalog # AAPY00221) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ELK4 |
| Uniprot ID |
P28324 |
| Protein Name |
ETS domain-containing protein Elk-4 |
| Protein Accession # |
NP_001964 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_001973 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ELK4 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100% |
| Image 1 |
 | 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.
|
|
