| Product Number |
ARP34128_P050 |
| Product Page |
www.avivasysbio.com/znf179-antibody-c-terminal-region-arp34128-p050.html |
| Name |
ZNF179 Antibody - C-terminal region (ARP34128_P050) |
| Protein Size (# AA) |
632 amino acids |
| Molecular Weight |
68kDa |
| NCBI Gene Id |
7732 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Ring finger protein 112 |
| Alias Symbols |
BFP, ZNF179 |
| Peptide Sequence |
Synthetic peptide located within the following region: GVALLCKGRDQTLEALEAELQATAKAFMDSYTMRFCGHLAAVGGAVGAGL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Seki,N., et al., (1999) DNA Res. 6 (5), 353-356 |
| Description of Target |
ZNF179 encodes a member of the RING finger protein family of transcription factors. The protein is primarily expressed in brain. The gene is located within the Smith-Magenis syndrome region on chromosome 17. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RNF112 (ARP34128_P050) antibody |
| Blocking Peptide |
For anti-RNF112 (ARP34128_P050) antibody is Catalog # AAP34128 (Previous Catalog # AAPP05601) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF179 |
| Uniprot ID |
Q9ULX5 |
| Protein Name |
RING finger protein 112 |
| Publications |
Goonetilleke, U. R. et al. Death is associated with complement C3 depletion in cerebrospinal fluid of patients with pneumococcal meningitis. MBio 3, (2012). 22415003 |
| Protein Accession # |
NP_009079 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_007148 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RNF112 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 92%; Guinea Pig: 92%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 86% |
| Image 1 | Human HepG2
 | WB Suggested Anti-ZNF179 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate |
| | Image 2 | Human Hela Whole Cell
 | Host: Rabbit
Target Name: RNF112
Sample Tissue: Human Hela Whole Cell
Antibody Dilution: 1ug/ml |
|
|
