PARP6 Antibody - C-terminal region (ARP34087_P050)

Data Sheet
 
Product Number ARP34087_P050
Product Page www.avivasysbio.com/parp6-antibody-c-terminal-region-arp34087-p050.html
Name PARP6 Antibody - C-terminal region (ARP34087_P050)
Protein Size (# AA) 519 amino acids
Molecular Weight 59kDa
NCBI Gene Id 56965
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Poly (ADP-ribose) polymerase family, member 6
Alias Symbols ARTD17, pART17, PARP-6-C, PARP-6-B1
Peptide Sequence Synthetic peptide located within the following region: KLPLSRLKFMHTSHQFLLLSSPPAKEARFRTAKKLYGSTFAFHGSHIENW
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kimura,K., (2006) Genome Res. 16 (1), 55-65
Description of Target Poly(ADP-ribose) polymerases (PARPs) constitute a large family of 18 proteins, encoded by different genes and displaying a conserved catalytic domain. They are involved in DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells.
Protein Interactions UBA5; ANKMY2; NSFL1C; RPRD1A; ARIH2; PLIN3; PLAA; SURF2; HK1; CBS;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PARP6 (ARP34087_P050) antibody
Blocking Peptide For anti-PARP6 (ARP34087_P050) antibody is Catalog # AAP34087 (Previous Catalog # AAPP23720)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human PARP6
Uniprot ID Q2NL67
Protein Name Poly [ADP-ribose] polymerase 6
Protein Accession # NP_064599
Purification Affinity Purified
Nucleotide Accession # NM_020214
Tested Species Reactivity Human
Gene Symbol PARP6
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human HepG2
WB Suggested Anti-PARP6 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Image 2
Human Intestine
Human Intestine
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com