| Product Number |
ARP33978_P050 |
| Product Page |
www.avivasysbio.com/tnks-antibody-middle-region-arp33978-p050.html |
| Name |
Tnks Antibody - middle region (ARP33978_P050) |
| Protein Size (# AA) |
1317 amino acids |
| Molecular Weight |
144kDa |
| NCBI Gene Id |
290794 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase |
| Alias Symbols |
- |
| Peptide Sequence |
Synthetic peptide located within the following region: GADPTLVNCHGKSAVDMAPTPELRERLTYEFKGHSLLQAAREADLAKVKK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Tnks (ARP33978_P050) antibody |
| Blocking Peptide |
For anti-Tnks (ARP33978_P050) antibody is Catalog # AAP33978 (Previous Catalog # AAPP05053) |
| Uniprot ID |
D3Z8Q6 |
| Protein Name |
Protein Tnks Ensembl ENSRNOP00000015813 |
| Protein Accession # |
NP_001099554 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001106084 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Tnks |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Rat Lung
 | WB Suggested Anti-Tnks Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Lung |
| | Image 2 | heart
 | Rabbit Anti-Tnks Antibody
Catalog Number: ARP33978_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult heart
Observed Staining: Cytoplasmic
Primary Antibody Concentration: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy2/3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 2.0 sec
Protocol located in Reviews and Data. |
|
|
