| Product Number |
ARP33950_T100 |
| Product Page |
www.avivasysbio.com/kifc2-antibody-n-terminal-region-arp33950-t100.html |
| Name |
KIFC2 Antibody - N-terminal region (ARP33950_T100) |
| Protein Size (# AA) |
838 amino acids |
| Molecular Weight |
90kDa |
| NCBI Gene Id |
90990 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Kinesin family member C2 |
| Peptide Sequence |
Synthetic peptide located within the following region: VRPPSPDGSTSQEESPSHFTAVPGEPLGDETQGQQPLQLEEDQRAWQRLE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Hanlon,D.W., et al., (1997) Neuron 18 (3), 439-451 |
| Description of Target |
Members of the kinesin superfamily of microtubule-associated proteins are involved in a variety of intracellular processes including cell division and organelle transport. KIFC2 encodes a 792 amino acid protein, which contains the conserved motor domain at the C-terminal end of the protein and is most similar to members of the KAR3 family involved in cell division. |
| Protein Interactions |
Dlg4; TEAD3; MAPK8IP2; TAB1; GET4; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-KIFC2 (ARP33950_T100) antibody |
| Blocking Peptide |
For anti-KIFC2 (ARP33950_T100) antibody is Catalog # AAP33950 (Previous Catalog # AAPP05025) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human KIFC2 |
| Uniprot ID |
Q96AC6 |
| Protein Name |
Kinesin-like protein KIFC2 |
| Protein Accession # |
NP_665697 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_145754 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
KIFC2 |
| Predicted Species Reactivity |
Human, Mouse, Cow, Horse |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Horse: 86%; Human: 100%; Mouse: 79% |
| Image 1 | Human Muscle
 | Human Muscle |
| | Image 2 | Human Jurkat
 | WB Suggested Anti-KIFC2 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate |
|
|
