| Product Number |
ARP33885_T100 |
| Product Page |
www.avivasysbio.com/pthlh-antibody-middle-region-arp33885-t100.html |
| Name |
PTHLH Antibody - middle region (ARP33885_T100) |
| Protein Size (# AA) |
175 amino acids |
| Molecular Weight |
20kDa |
| NCBI Gene Id |
5744 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Parathyroid hormone-like hormone |
| Description |
|
| Alias Symbols |
HHM, PLP, BDE2, PTHR, PTHRP |
| Peptide Sequence |
Synthetic peptide located within the following region: YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Chen,C., et al., (2004) J. Biol. Chem. 279 (28), 29121-29129 |
| Description of Target |
PTHLH is a member of the parathyroid hormone family. This hormone regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. This hormone is involved in lactation possibly by regulating the mobilization and transfer of calcium to the milk. The receptor of this hormone, PTHR1, is responsible for most cases of humoral hypercalcemia of malignancy. Four alternatively spliced transcript variants encoding two distinct isoforms have been observed. |
| Protein Interactions |
ELAVL1; PLK1; KPNB1; KLK3; PTH1R; IL6; CDK2; ARRB1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PTHLH (ARP33885_T100) antibody |
| Blocking Peptide |
For anti-PTHLH (ARP33885_T100) antibody is Catalog # AAP33885 (Previous Catalog # AAPP04956) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PTHLH |
| Uniprot ID |
P12272 |
| Protein Name |
Parathyroid hormone-related protein |
| Publications |
Müller, M., Gagiannis, S., Nawroth, P. P., Brune, M. & Schilling, T. Activation of the receptor for parathyroid hormone and parathyroid hormone related protein induces apoptosis via the extrinsic and intrinsic signaling pathway. Int. J. Mol. Med. 24, 373-80 (2009). 19639230
Role of the Parathyroid Hormone Type 1 Receptor (PTH1R) as a Mechanosensor in Osteocyte Survival. J Bone Miner Res. 30, 1231-44 (2015). 25529820
Zhao, C.-M. et al. Gene expression profiling of gastric mucosa in mice lacking CCK and gastrin receptors. Regul. Pept. 192-193C, 35-44 (2014). 25160855 |
| Protein Accession # |
NP_002811 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_002820 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PTHLH |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-PTHLH Antibody Titration: 2.0ug/ml
Positive Control: HepG2 cell lysate |
|
| Image 2 | Human , Mouse, Rat
 | Primary antibody dilution: 1:1000
Secondary antibody: Goat anti-rabbit HRP
Secondary antibody dilution:1:2000 |
|
| Image 3 | Human Lung
 | IHC Information:Rabbit Anti-PTHLH Antibody
Catalog Number: ARP33885
Paraffin Embedded Tissue: Human Lung
Cellular Data: Alveolar cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
| Image 4 | Human kidney
 | Rabbit Anti-PTHLH Antibody
Catalog Number: ARP33885
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of collecting tubule and renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
