SMPDL3B Antibody - N-terminal region (ARP33875_P050)

• Product Number: ARP33875_P050
• Name: SMPDL3B Antibody - N-terminal region (ARP33875_P050)
• Protein Size (# AA): 463 amino acids
• Molecular Weight: 52 kDa
• NCBI Gene Id: 27293
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Sphingomyelin phosphodiesterase, acid-like 3B
• Description:
  View product citations for SMPDL3B Antibody - N-terminal region (ARP33875_P050) on CiteAb
• Alias Symbols: ASML3B
• Peptide Sequence: Synthetic peptide located within the following region: ILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Strausberg,R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
• Description of Target: Located on chromosome 1, this gene encodes for acid sphingomyelinase-like phosphodiesterase 3b precursor protein.
• Protein Interactions: PAN2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-SMPDL3B (ARP33875_P050) antibody is Catalog # AAP33875 (Previous Catalog # AAPP04946)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SMPDL3B
• Uniprot ID: Q92485
• Protein Name: Acid sphingomyelinase-like phosphodiesterase 3b
• Publications:

  Sphingomyelin phosphodiesterase acid-like 3A (SMPDL3A) is a novel nucleotide phosphodiesterase regulated by cholesterol in human macrophages. J Biol Chem. 289, 32895-913 (2014). 25288789

• Sample Type Confirmation:

  SMPDL3B is supported by BioGPS gene expression data to be expressed in Raji

• Protein Accession #: NP_055289
• Purification: Affinity Purified
• Nucleotide Accession #: NM_014474
• Tested Species Reactivity: Human
• Gene Symbol: SMPDL3B
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Dog: 85%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 85%; Rabbit: 92%; Rat: 85%; Zebrafish: 85%
• Image 1: Human Intestine
  
  Human Intestine
• Image 2: Human Fetal Lung
  
  Host: Rabbit
  Target Name: SMPDL3B
  Sample Tissue: Human Fetal Lung
  Antibody Dilution: 1.0ug/ml
• Image 3: Human HT1080 Whole Cell
  
  Host: Rabbit
  Target Name: SMPDL3B
  Sample Tissue: Human HT1080 Whole Cell
  Antibody Dilution: 1ug/ml