ASGR2 Antibody - N-terminal region (ARP33821_T100)

Data Sheet
 
Product Number ARP33821_T100
Product Page www.avivasysbio.com/asgr2-antibody-n-terminal-region-arp33821-t100.html
Name ASGR2 Antibody - N-terminal region (ARP33821_T100)
Protein Size (# AA) 311 amino acids
Molecular Weight 34kDa
NCBI Gene Id 433
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Asialoglycoprotein receptor 2
Alias Symbols HL-2, HBXBP, ASGPR2, ASGP-R2, CLEC4H2
Peptide Sequence Synthetic peptide located within the following region: STLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Yik,J.H.,et al., (2002) J.Biol.Chem.277(43),40844-40852
Description of Target ASGR2 is a cell surface receptor that binds to galactose-terminated glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociates. Then the receptor is recycled back to the cell surface. There are four alternatively spliced transcript variants of this gene. This gene has multiple polyadenylation sites.
Protein Interactions MROH5; CERS2; HES1; GLUD1; VKORC1; Sec61b; ERLEC1; OS9; SYVN1; DERL1; FBXO6; EDEM1; F8; ASGR2; ASGR1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ASGR2 (ARP33821_T100) antibody
Blocking Peptide For anti-ASGR2 (ARP33821_T100) antibody is Catalog # AAP33821 (Previous Catalog # AAPP04887)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ASGR2
Uniprot ID P07307
Protein Name Asialoglycoprotein receptor 2
Sample Type Confirmation

ASGR2 is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_001172
Purification Protein A purified
Nucleotide Accession # NM_001181
Tested Species Reactivity Human
Gene Symbol ASGR2
Predicted Species Reactivity Human, Pig
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Pig: 77%
Image 1
Human Spleen
Human Spleen
Image 2
Human HepG2
Host: Rabbit
Target Name: ASGR2
Sample Tissue: Human HepG2
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com