| Product Number |
ARP33814_P050 |
| Product Page |
www.avivasysbio.com/c4bpb-antibody-n-terminal-region-arp33814-p050.html |
| Name |
C4BPB Antibody - N-terminal region (ARP33814_P050) |
| Protein Size (# AA) |
252 amino acids |
| Molecular Weight |
28kDa |
| NCBI Gene Id |
725 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Complement component 4 binding protein, beta |
| Alias Symbols |
C4BP |
| Peptide Sequence |
Synthetic peptide located within the following region: CCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Anderson,N.L., et al., (2004) Mol. Cell Proteomics 3 (4), 311-326 |
| Description of Target |
C4BPB is a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. A single, unique beta-chain encoded by this gene assembles with seven identical alpha-chains into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. C4b-binding protein has a regulatory role in the coagulation system also, mediated through the beta-chain binding of protein S, a vitamin K-dependent protein that serves as a cofactor of activated protein C. |
| Protein Interactions |
UBC; PROS1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-C4BPB (ARP33814_P050) antibody |
| Blocking Peptide |
For anti-C4BPB (ARP33814_P050) antibody is Catalog # AAP33814 (Previous Catalog # AAPP04880) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human C4BPB |
| Uniprot ID |
P20851 |
| Protein Name |
C4b-binding protein beta chain |
| Sample Type Confirmation |
C4BPB is supported by BioGPS gene expression data to be expressed in 721_B |
| Protein Accession # |
NP_000707 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000716 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
C4BPB |
| Predicted Species Reactivity |
Human, Dog, Pig |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 86%; Human: 100%; Pig: 93% |
| Image 1 | Human kidney
 | Human kidney |
|
| Image 2 | Human Liver
 | WB Suggested Anti-C4BPB Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver |
|
| Image 3 | Human 721_B
 | Host: Rabbit
Target Name: C4BPB
Sample Type: 721_B
Antibody Dilution: 1.0ug/mlC4BPB is supported by BioGPS gene expression data to be expressed in 721_B |
|
