PARP11 Antibody - N-terminal region (ARP33768_T100)

• Product Number: ARP33768_T100
• Name: PARP11 Antibody - N-terminal region (ARP33768_T100)
• Protein Size (# AA): 331 amino acids
• Molecular Weight: 39kDa
• NCBI Gene Id: 57097
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Poly (ADP-ribose) polymerase family, member 11
• Alias Symbols: ARTD11, MIB006, C12orf6
• Peptide Sequence: Synthetic peptide located within the following region: SAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTM
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Puente,X.S., et al., (2003) Nat. Rev. Genet. 4 (7), 544-558
• Protein Interactions: MDFI; TRIP13; DCAF11; RNF114; OTUD4; LYZ; GTPBP3; NUP98;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PARP11 (ARP33768_T100) antibody is Catalog # AAP33768
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PARP11
• Uniprot ID: Q9NR21
• Protein Name: Poly [ADP-ribose] polymerase 11
• Protein Accession #: NP_065100
• Purification: Protein A purified
• Nucleotide Accession #: NM_020367
• Tested Species Reactivity: Human
• Gene Symbol: PARP11
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 91%; Pig: 100%; Rabbit: 93%; Rat: 79%
• Image 1: Human HepG2
  
  WB Suggested Anti-PARP11 Antibody
  Titration: 2.5 ug/ml
  Positive Control: HepG2 Whole Cell